PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g102740.2.1
Common NameLOC101250453
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 414aa    MW: 46927.9 Da    PI: 6.6308
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g102740.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.65.9e-50511762128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                         +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ +
  Solyc01g102740.2.1  51 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMI 140
                         79***************************.89***************8778899************************************* PP

                 NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++++ +glkktLvfy+g+apkg +++W+m+eyrl
  Solyc01g102740.2.1 141 RTENSRSIGLKKTLVFYSGKAPKGIRSSWIMNEYRL 176
                         **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.00250197IPR003441NAC domain
SuperFamilySSF1019411.11E-5550196IPR003441NAC domain
PfamPF023654.8E-2552176IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MAIVPFITTN MSQSQQQHQQ QQDDDDNNNI NNTIKGDDND DDDDHEHDMV MPGFRFHPTE  60
EELVEFYLRR KVEGKRFNVE LITFLDLYRY DPWELPALAA IGEKEWYFYV PRDRKYRNGD  120
RPNRVTTSGY WKATGADRMI RTENSRSIGL KKTLVFYSGK APKGIRSSWI MNEYRLPHHE  180
TERLQKAEIS LCRVYKRAGV EDHPSLPRSL LTTRASSSSS SRGTTPIKKQ QVAQQDSSLI  240
SPLYLGQSSQ QQIDEKLSTE TSASSTSTDH HHHHQHHVAT SLGLNSLSNS YTNIALDPIG  300
SAVNITTSTL TPFTSLVATT NNTTDDLHRL INLDQVVAFH NNQHHFHPPP GVVPQQYPPP  360
LLLQQPQSLL HQGSLPSSAA AAFSDRLWEW NSINQTDGSC KDDHYDQGNN PFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-565219719165NO APICAL MERISTEM PROTEIN
1ut4_B4e-565219719165NO APICAL MERISTEM PROTEIN
1ut7_A4e-565219719165NO APICAL MERISTEM PROTEIN
1ut7_B4e-565219719165NO APICAL MERISTEM PROTEIN
4dul_A4e-565219719165NAC domain-containing protein 19
4dul_B4e-565219719165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.209650.0cell culture| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2462550.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-65j3 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230395.10.0PREDICTED: NAC domain-containing protein 55 isoform X2
TrEMBLK4B1K20.0K4B1K2_SOLLC; Uncharacterized protein
STRINGSolyc01g102740.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-109NAC domain containing protein 35
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]